PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G12670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 519aa    MW: 56328.2 Da    PI: 7.6693
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G12670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.28e-1481118240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +kk+CnCk+s+Clk+YCeCfaag +C+  C+C++C N  
  OPUNC06G12670.1  81 RKKHCNCKNSQCLKLYCECFAAGLYCDG-CHCKQCGNYV 118
                      689*************************.*******975 PP

2TCR50.93.1e-16165204140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC+dCkN e
  OPUNC06G12670.1 165 KHNKGCHCKKSGCLKKYCECFQANILCSKNCKCQDCKNFE 204
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.7E-1380120IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.40481205IPR005172CRC domain
PfamPF036381.3E-1082117IPR005172CRC domain
SMARTSM011141.5E-18165206IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12168203IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MEKKEMQQQP QPESEPEPAA PARPPAPAAA AEAKATPPPP QPQPKPAAPV HPLMPTPRPW  60
PVAFIPPKPV AEIKSAPSTK RKKHCNCKNS QCLKLYCECF AAGLYCDGCH CKQCGNYVGN  120
ESARQEAINS TKQRNPKAFQ PKIENCSTAL NPRKDDAGAP ASLPKHNKGC HCKKSGCLKK  180
YCECFQANIL CSKNCKCQDC KNFEGSEELR LITQGDNSSD RNNIQHAANV ALNGAIGSSG  240
YRYSPVRRKR PTEDPRCQKL NGEGSMMQSQ FQEANHVDSS EITSSTGLEG CYSNYQGRSN  300
VVYRSTLANT ISPTDATGLA KHLVIVCRKA ADAFLTTAEN KMEMEVERGI HTNSDSATNM  360
DQQNGGDFGP CCNSLEDSRP ASPGTQALMC DEQGSTFGTD YRISFPVALH DQDTSELNAQ  420
QEKAVLTGFR DYLRTVITRG KINALTFFVS LIFNGCSTGI TEANRSSEAA MQLDTRKRDE  480
STTILPPLNA VEKEKLEVPD GPESPKASPS ASNCGDQAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8362560.0CT836256.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA111J17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641295.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
TrEMBLA0A0E0LB860.0A0A0E0LB86_ORYPU; Uncharacterized protein
STRINGLOC_Os06g22670.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.27e-85Tesmin/TSO1-like CXC domain-containing protein